Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NSMCE4A Rabbit Polyclonal Antibody (Biotin)

NSMCE4A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

NS4EA, NSE4A, C10orf86

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human NSMCE4A

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NEENEGFEHNTQVRNQGIIALSYRDWEIVKTFEISEPVITPSQRQQKPSA

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001161337

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Merlin (Ser10) Colorimetric Cell-Based ELISA Kit
MBS9501608-01 1 Kit

Phospho-Merlin (Ser10) Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
Phospho-Merlin (Ser10) Colorimetric Cell-Based ELISA Kit
MBS9501608-02 5x 1 Kit

Phospho-Merlin (Ser10) Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
Bpi 3'UTR GFP Stable Cell Line
TU152811 1.0 mL

Bpi 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
LAMC2 Antibody [J11A23]
F3711-100uL 100 µL

LAMC2 Antibody [J11A23]

Sign In for Pricing
View Details
Rat Slc34a1 Pre-designed siRNA Set B
SI213110B 1 Each

Rat Slc34a1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Anti-HSD11B2 Antibody Picoband®, Dylight594 Conjugate
A01613-Dylight594 100 µg

Anti-HSD11B2 Antibody Picoband®, Dylight594 Conjugate

Sign In for Pricing
View Details