Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NTN5 Rabbit Polyclonal Antibody (HRP)

NTN5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q8WTR8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human NTN5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QCHPIGATGGTCNQTSGQCTCKLGVTGLTCNRCGPGYQQSRSPRMPCQRI

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bcl-2 Antibody
MBS809814-01 0.1 mg

Bcl-2 Antibody

Sign In for Pricing
View Details
Bcl-2 Antibody
MBS809814-02 5x 0.1 mg

Bcl-2 Antibody

Sign In for Pricing
View Details
Canine Cytosolic phospholipase A2 zeta (PLA2G4F) ELISA Kit
MBS7204863-01 48 Well

Canine Cytosolic phospholipase A2 zeta (PLA2G4F) ELISA Kit

Sign In for Pricing
View Details
Canine Cytosolic phospholipase A2 zeta (PLA2G4F) ELISA Kit
MBS7204863-02 96 Well

Canine Cytosolic phospholipase A2 zeta (PLA2G4F) ELISA Kit

Sign In for Pricing
View Details
Canine Cytosolic phospholipase A2 zeta (PLA2G4F) ELISA Kit
MBS7204863-03 5x 96 Well

Canine Cytosolic phospholipase A2 zeta (PLA2G4F) ELISA Kit

Sign In for Pricing
View Details
Canine Cytosolic phospholipase A2 zeta (PLA2G4F) ELISA Kit
MBS7204863-04 10x 96 Well

Canine Cytosolic phospholipase A2 zeta (PLA2G4F) ELISA Kit

Sign In for Pricing
View Details