Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUDT8 Rabbit Polyclonal Antibody (Biotin)

NUDT8 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q8WV74

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human NUDT8

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SFPGGKCDPADQDVVHTALRETREELGLAVPEEHVWGLLRPVYDPQKATV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLV3-U6-CAPN8-shRNA1-CopGFP-Puro Plasmid
PVT80317 2 µg

PLV3-U6-CAPN8-shRNA1-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
Rat IGFBP-7 (Insulin-like growth factor-binding protein 7) ELISA Kit
ER1686 96 Tests

Rat IGFBP-7 (Insulin-like growth factor-binding protein 7) ELISA Kit

Sign In for Pricing
View Details
DRC7 (NM_032269) Human Recombinant Protein
PROTQ8IY82 20 µg

DRC7 (NM_032269) Human Recombinant Protein

Sign In for Pricing
View Details
Paralemmin (PALM) Human shRNA Plasmid Kit (Locus ID 5064)
TR310619 1 Kit

Paralemmin (PALM) Human shRNA Plasmid Kit (Locus ID 5064)

Sign In for Pricing
View Details
C6orf41 CRISPR Knock Out 293T Cell Line (Human)
53841141 1x 10^6 Cells / 1.0 mL

C6orf41 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Col8a1 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3645803 1.0 µg DNA

Col8a1 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details