Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUDT8 Rabbit Polyclonal Antibody (HRP)

NUDT8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q8WV74

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human NUDT8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SFPGGKCDPADQDVVHTALRETREELGLAVPEEHVWGLLRPVYDPQKATV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CREB1 pSer133 Rabbit Polyclonal Antibody
AP01566PU-N 100 µg

CREB1 pSer133 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CA13 Rabbit Polyclonal Antibody
TA374170 100 µL

CA13 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Vrk2 Mouse Gene Knockout Kit (CRISPR)
KN519272 1 Kit

Vrk2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Deoxycorticosterone 21-Glucoside
TRC-D232708-50MG 50 mg

Deoxycorticosterone 21-Glucoside

Sign In for Pricing
View Details
Nonanoyl Coenzyme A Sodium Salt
TRC-N649390-1MG 1 mg

Nonanoyl Coenzyme A Sodium Salt

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB502450 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details