Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUDT8 Rabbit Polyclonal Antibody (HRP)

NUDT8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q8WV74

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human NUDT8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SFPGGKCDPADQDVVHTALRETREELGLAVPEEHVWGLLRPVYDPQKATV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pit1 (POU1F1) (NM_000306) Human Over-expression Lysate
LC424805 20 µg

Pit1 (POU1F1) (NM_000306) Human Over-expression Lysate

Sign In for Pricing
View Details
Pseudomonas aeruginosa serotype 6C (1200/472), CF640R conjugate, 0.1mg/mL
BNC400240-100 1x 100 µL

Pseudomonas aeruginosa serotype 6C (1200/472), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (K8/383), 1mg/mL
BNUM0383-50 1x 50 µL

Cytokeratin 8 (K8/383), 1mg/mL

Sign In for Pricing
View Details
AGO1 (NM_012199) Human Recombinant Protein
TP761918 50 µg

AGO1 (NM_012199) Human Recombinant Protein

Sign In for Pricing
View Details
Benz[j]aceanthrylen-2(1H)-one13C2 and Benz[e]aceanthrylen-6(5H)-one13C2
TRC-B183542-25MG 25 mg

Benz[j]aceanthrylen-2(1H)-one13C2 and Benz[e]aceanthrylen-6(5H)-one13C2

Sign In for Pricing
View Details
α, ω-Bis-Succinamic Acid NHS Ester PEG
113000-35.5G 5 g

α, ω-Bis-Succinamic Acid NHS Ester PEG

Sign In for Pricing
View Details