Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR1L1 Rabbit Polyclonal Antibody (HRP)

OR1L1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HG23, OR1L2, OR9-C, OR9-27

UniProt

Q8NH94

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human OR1L1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EPTTMGRNNLTRPSEFILLGLSSRPEDQKPLFAVFLPIYLITVIGNLLII

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Axin-2 Antibody (S06-3A8)
NBP3-14909-25ul 25 µL

Rabbit Monoclonal Axin-2 Antibody (S06-3A8)

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to PODXL
E10-32179 100 µL

Mouse Monoclonal Antibody to PODXL

Sign In for Pricing
View Details
Human CPN2 Protein Lysate
MBS139847-01 0.02 mg

Human CPN2 Protein Lysate

Sign In for Pricing
View Details
Human CPN2 Protein Lysate
MBS139847-02 5x 0.02 mg

Human CPN2 Protein Lysate

Sign In for Pricing
View Details
FAM148C (h) -PR
sc-97732-PR 10 µM - 20 µL

FAM148C (h) -PR

Sign In for Pricing
View Details
KAL1 (ANOS1) Mouse Monoclonal Antibody [Clone:5E10]
E45M18557 100 µg

KAL1 (ANOS1) Mouse Monoclonal Antibody [Clone:5E10]

Sign In for Pricing
View Details