Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR1L4 Rabbit Polyclonal Antibody (Biotin)

OR1L4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

OR1L5, OR9-E, OR9-29, OST046

UniProt

Q8NGR5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR1L4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VYFRPLSMYSVMKGRVATVMYTVVTPMLNPFIYSLRNKDMKRGLKKLRHR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001005235

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Major Vault Protein ELISA Kit
MBS024499-01 48 Well

Rat Major Vault Protein ELISA Kit

Sign In for Pricing
View Details
Rat Major Vault Protein ELISA Kit
MBS024499-02 96 Well

Rat Major Vault Protein ELISA Kit

Sign In for Pricing
View Details
Rat Major Vault Protein ELISA Kit
MBS024499-03 5x 96 Well

Rat Major Vault Protein ELISA Kit

Sign In for Pricing
View Details
Rat Major Vault Protein ELISA Kit
MBS024499-04 10x 96 Well

Rat Major Vault Protein ELISA Kit

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Coaulation Factor XI (F11)
MBS2148403-01 0.1 mL

PE-Linked Monoclonal Antibody to Coaulation Factor XI (F11)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Coaulation Factor XI (F11)
MBS2148403-02 0.2 mL

PE-Linked Monoclonal Antibody to Coaulation Factor XI (F11)

Sign In for Pricing
View Details