Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR1N1 Rabbit Polyclonal Antibody (HRP)

OR1N1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OR1N3, OR1-26, OR9-22

UniProt

Q8NGS0

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR1N1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PPSIASEEKDIAAAAMYTIVTPMLNPFIYSLRNKDMKGALKRLFSHRSIV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_036495

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF346 Rabbit Polyclonal Antibody
TA365395 100 µL

ZNF346 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FPGT (NM_001199329) Human Tagged ORF Clone
RG236351 10 µg

FPGT (NM_001199329) Human Tagged ORF Clone

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1798), CF488A conjugate, 0.1mg/mL
BNC881798-500 1x 500 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1798), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX9 / SRY-box 9 (PCRP-SOX9-1A2), CF568 conjugate, 0.1mg/mL
BNC681927-500 1x 500 µL

SOX9 / SRY-box 9 (PCRP-SOX9-1A2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD62L Antibody[HI62L]
E-AB-F1336J-01 20 Tests

PerCP/Cyanine5.5 Anti-Human CD62L Antibody[HI62L]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD62L Antibody[HI62L]
E-AB-F1336J-02 100 Tests

PerCP/Cyanine5.5 Anti-Human CD62L Antibody[HI62L]

Sign In for Pricing
View Details