Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2A12 Rabbit Polyclonal Antibody (FITC)

OR2A12 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

OR2A12P, OR2A16P

UniProt

Q8NGT7

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR2A12

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: IQSGEGRRKAFSTCSSHLCVVGLFFGSAIVMYMAPKSSHSQERRKILSLF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse

Tested Applications

WB

NCBI Accession Number

NP_001004135

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NRP1 (VEGF165R, Neuropilin-1, Vascular Endothelial Cell Growth Factor 165 Receptor, CD304, DKFZp686A03134, DKFZp781F1414) (PE)
130574-PE 100 µL

NRP1 (VEGF165R, Neuropilin-1, Vascular Endothelial Cell Growth Factor 165 Receptor, CD304, DKFZp686A03134, DKFZp781F1414) (PE)

Sign In for Pricing
View Details
GPRIN3 Immunizing Peptide
orb737763 100 µg

GPRIN3 Immunizing Peptide

Sign In for Pricing
View Details
CD92 (CD92 Antigen, CD92 Protein, CDw92, CDw92 Antigen, Choline Transporter-like Protein 1, CHTL1, CTL1, RP11-287A8.1, Solute Carrier Family 44 Member 1, SLC44A1) (FITC) discontinued
C2441-98A2-FITC 100 µL

CD92 (CD92 Antigen, CD92 Protein, CDw92, CDw92 Antigen, Choline Transporter-like Protein 1, CHTL1, CTL1, RP11-287A8.1, Solute Carrier Family 44 Member 1, SLC44A1) (FITC) discontinued

Sign In for Pricing
View Details
CRLF3 Knockout AGS Polyclonal Cells
ARG2241 1 Million

CRLF3 Knockout AGS Polyclonal Cells

Sign In for Pricing
View Details
ASP-4000 HCl
orb1698316-01 25 mg

ASP-4000 HCl

Sign In for Pricing
View Details
ASP-4000 HCl
orb1698316-02 50 mg

ASP-4000 HCl

Sign In for Pricing
View Details