Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2A25 Rabbit Polyclonal Antibody (HRP)

OR2A25 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OR2A27, OR2A24P, OR2A25P

UniProt

A4D2G3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR2A25

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LCVVGLFYGTAIIMYVEPQYESPKEQKKYLLLFHSLFNPMLNPLIYSLRN

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_001004488

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 20 Antibody / KRT20 / CK20
V3909SAF-100UG 100 µg

Cytokeratin 20 Antibody / KRT20 / CK20

Sign In for Pricing
View Details
Rabbit connective tissue-activating peptide III (CTAP III) ELISA Kit
MBS2601619-01 48 Well

Rabbit connective tissue-activating peptide III (CTAP III) ELISA Kit

Sign In for Pricing
View Details
Rabbit connective tissue-activating peptide III (CTAP III) ELISA Kit
MBS2601619-02 96 Well

Rabbit connective tissue-activating peptide III (CTAP III) ELISA Kit

Sign In for Pricing
View Details
Rabbit connective tissue-activating peptide III (CTAP III) ELISA Kit
MBS2601619-03 5x 96 Well

Rabbit connective tissue-activating peptide III (CTAP III) ELISA Kit

Sign In for Pricing
View Details
Rabbit connective tissue-activating peptide III (CTAP III) ELISA Kit
MBS2601619-04 10x 96 Well

Rabbit connective tissue-activating peptide III (CTAP III) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human CRYAB shRNA (UAS) - Lentiviral human CRYAB shRNA (UAS, GFP) plasmid
GTR15084934 1 Vial

Lentiviral human CRYAB shRNA (UAS) - Lentiviral human CRYAB shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details