Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2A25 Rabbit Polyclonal Antibody (Biotin)

OR2A25 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

OR2A27, OR2A24P, OR2A25P

UniProt

A4D2G3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR2A25

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IIMYVEPQYESPKEQKKYLLLFHSLFNPMLNPLIYSLRNKEVQGTLKRML

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001004488

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MASTL (MASTL, GW, GWL, THC2, Serine/threonine-protein kinase greatwall, Microtubule-associated serine/threonine-protein kinase-like) (MaxLight 750) discontinued
031113-ML750 100 µL

MASTL (MASTL, GW, GWL, THC2, Serine/threonine-protein kinase greatwall, Microtubule-associated serine/threonine-protein kinase-like) (MaxLight 750) discontinued

Sign In for Pricing
View Details
MRLC2 (MYL12B, MYLC2B, Myosin Regulatory Light Chain 12B, MLC-2A, Myosin Regulatory Light Chain 2-B, Smooth Muscle Isoform, Myosin Regulatory Light Chain 20kD, Myosin Regulatory Light Chain MRLC2, SHUJUN-1) (MaxLight 750) discontinued
129851-ML750 100 µL

MRLC2 (MYL12B, MYLC2B, Myosin Regulatory Light Chain 12B, MLC-2A, Myosin Regulatory Light Chain 2-B, Smooth Muscle Isoform, Myosin Regulatory Light Chain 20kD, Myosin Regulatory Light Chain MRLC2, SHUJUN-1) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Bovine Putative tyrosine-protein phosphatase auxilin, DNAJC6 ELISA Kit
MBS9332226-01 48 Well

Bovine Putative tyrosine-protein phosphatase auxilin, DNAJC6 ELISA Kit

Sign In for Pricing
View Details
Bovine Putative tyrosine-protein phosphatase auxilin, DNAJC6 ELISA Kit
MBS9332226-02 96 Well

Bovine Putative tyrosine-protein phosphatase auxilin, DNAJC6 ELISA Kit

Sign In for Pricing
View Details
Bovine Putative tyrosine-protein phosphatase auxilin, DNAJC6 ELISA Kit
MBS9332226-03 5x 96 Well

Bovine Putative tyrosine-protein phosphatase auxilin, DNAJC6 ELISA Kit

Sign In for Pricing
View Details
Bovine Putative tyrosine-protein phosphatase auxilin, DNAJC6 ELISA Kit
MBS9332226-04 10x 96 Well

Bovine Putative tyrosine-protein phosphatase auxilin, DNAJC6 ELISA Kit

Sign In for Pricing
View Details