Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2A25 Rabbit Polyclonal Antibody (HRP)

OR2A25 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OR2A27, OR2A24P, OR2A25P

UniProt

A4D2G3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR2A25

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IIMYVEPQYESPKEQKKYLLLFHSLFNPMLNPLIYSLRNKEVQGTLKRML

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001004488

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kallikrein 5 (Kallikrein-5, KLK5, Kallikrein-like Protein 2, KLKL2, KLK-L2, Kallikrein-related Peptidase 5, Stratum Corneum Tryptic Enzyme, SCTE, UNQ570/PRO1132) (HRP)
MBS6484045-01 0.2 mL

Kallikrein 5 (Kallikrein-5, KLK5, Kallikrein-like Protein 2, KLKL2, KLK-L2, Kallikrein-related Peptidase 5, Stratum Corneum Tryptic Enzyme, SCTE, UNQ570/PRO1132) (HRP)

Sign In for Pricing
View Details
Kallikrein 5 (Kallikrein-5, KLK5, Kallikrein-like Protein 2, KLKL2, KLK-L2, Kallikrein-related Peptidase 5, Stratum Corneum Tryptic Enzyme, SCTE, UNQ570/PRO1132) (HRP)
MBS6484045-02 5x 0.2 mL

Kallikrein 5 (Kallikrein-5, KLK5, Kallikrein-like Protein 2, KLKL2, KLK-L2, Kallikrein-related Peptidase 5, Stratum Corneum Tryptic Enzyme, SCTE, UNQ570/PRO1132) (HRP)

Sign In for Pricing
View Details
Lentiviral human COPG1 shRNA (UAS) - Lentiviral human COPG1 shRNA (UAS, GFP) (100)
GTR15091413 1 Vial

Lentiviral human COPG1 shRNA (UAS) - Lentiviral human COPG1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
ZNF75A, ID (ZNF75A, Zinc finger protein 75A) (AP) discontinued
044354-AP 200 µL

ZNF75A, ID (ZNF75A, Zinc finger protein 75A) (AP) discontinued

Sign In for Pricing
View Details
Anti-AHSG Antibody (R2Y16)
RHC01203 100 μg

Anti-AHSG Antibody (R2Y16)

Sign In for Pricing
View Details
Human SULT4A1 qPCR Primer Pair
QH36701S 200 Tests

Human SULT4A1 qPCR Primer Pair

Sign In for Pricing
View Details