Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2G6 Rabbit Polyclonal Antibody (HRP)

OR2G6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q5TZ20

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR2G6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SAAGRQKAFGTCSSHLVVVIIFYGTIIFMYLQPANRRSKNQGKFVSLFYT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001013373

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POU3F2 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
37261124 3x 1.0µg DNA

POU3F2 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
ANKRD20A2 Human shRNA Plasmid Kit (Locus ID 441430)
TL314788 1 Kit

ANKRD20A2 Human shRNA Plasmid Kit (Locus ID 441430)

Sign In for Pricing
View Details
BMI1 Immunizing Peptide
orb738050 100 µg

BMI1 Immunizing Peptide

Sign In for Pricing
View Details
Rabbit Polyclonal CTRP2 Antibody [Alexa Fluor 350]
NBP1-76627AF350 0.1 mL

Rabbit Polyclonal CTRP2 Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
Anxa1 3'UTR Luciferase Stable Cell Line
TU200692 1.0 mL

Anxa1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
NDUFV1 Double Nickase Plasmid (m)
sc-421845-NIC 20 µg

NDUFV1 Double Nickase Plasmid (m)

Sign In for Pricing
View Details