Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2S2 Rabbit Polyclonal Antibody (HRP)

OR2S2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OR37A, OST715

UniProt

Q9NQN1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR2S2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KKVFSTCSAHLTVVIVFYGTLFFMYGKPKSKDSMGADKEDLSDKLIPLFY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_063950

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GARNL1 CRISPR/Cas9 KO Plasmid (m)
sc-425302 20 µg

GARNL1 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
C7orf50 sgRNA CRISPR Lentivector set (Human)
K0255701 3x 1.0 µg

C7orf50 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Lentiviral human KLRG2 shRNA (UAS) - Lentiviral human KLRG2 shRNA (UAS, GFP) (100)
GTR15084273 1 Vial

Lentiviral human KLRG2 shRNA (UAS) - Lentiviral human KLRG2 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
MAb mouse anti-human IFN-γ
CT216 0.5 mg

MAb mouse anti-human IFN-γ

Sign In for Pricing
View Details
Rgp1 Mouse shRNA Plasmid (Locus ID 242406)
TR510702 1 Kit

Rgp1 Mouse shRNA Plasmid (Locus ID 242406)

Sign In for Pricing
View Details
TNNT2 (Troponin T, Cardiac Muscle, TnTc, Cardiac Muscle Troponin T, cTnT, CMH2, CMPD2, LVNC6, RCM3) (MaxLight 405)
MBS6193119-01 0.1 mL

TNNT2 (Troponin T, Cardiac Muscle, TnTc, Cardiac Muscle Troponin T, cTnT, CMH2, CMPD2, LVNC6, RCM3) (MaxLight 405)

Sign In for Pricing
View Details