Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2W3 Rabbit Polyclonal Antibody (HRP)

OR2W3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OR2W3P, OR2W8P, OST718

UniProt

Q7Z3T1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR2W3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IIYMYMQPGASSSQDQGMFLMLFYNIVTPLLNPLIYTLRNREVKGALGRL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001001957

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cross Linked C-Telopeptide Of Type I Collagen (CTXI) ELISA Kit
orb1666918-01 48 Tests

Mouse Cross Linked C-Telopeptide Of Type I Collagen (CTXI) ELISA Kit

Sign In for Pricing
View Details
Mouse Cross Linked C-Telopeptide Of Type I Collagen (CTXI) ELISA Kit
orb1666918-02 96 Tests

Mouse Cross Linked C-Telopeptide Of Type I Collagen (CTXI) ELISA Kit

Sign In for Pricing
View Details
AADAT Rabbit Polyclonal Antibody (Biotin)
orb2120575 100 µL

AADAT Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
GPT2 siRNA (Human)
CRJ3595-01 15 nmol

GPT2 siRNA (Human)

Sign In for Pricing
View Details
GPT2 siRNA (Human)
CRJ3595-02 30 nmol

GPT2 siRNA (Human)

Sign In for Pricing
View Details
Rapgef2 3'UTR GFP Stable Cell Line
TU267304 1.0 mL

Rapgef2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details