Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR3A3 Rabbit Polyclonal Antibody (FITC)

OR3A3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

OR3A6, OR3A7, OR3A8P, OR17-16, OR17-137, OR17-201

UniProt

P47888

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR3A3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MRLGSVESSDKDKGVGVFMTVINPMLNPLIYSLRNTDVQGALCQLLVGKR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_036505

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Methyl-N- (3-chloropropyl) homoveratrylamine Hydrochloride
165437 500 mg

N-Methyl-N- (3-chloropropyl) homoveratrylamine Hydrochloride

Sign In for Pricing
View Details
NRAS (Neuroblastoma RAS Viral (v-ras) Oncogene Homolog, N-Ras, ALPS4, AV095280, GTPase NRas, HRAS1, N-Ras Protein Part 4, NRAS1, OTTHUMP00000013879, OTTMUSP00000023521, Transforming Protein N-Ras, v-Ras Neuroblastoma RAS Viral Oncogene Homolog)
N5385-01A 100 µg

NRAS (Neuroblastoma RAS Viral (v-ras) Oncogene Homolog, N-Ras, ALPS4, AV095280, GTPase NRas, HRAS1, N-Ras Protein Part 4, NRAS1, OTTHUMP00000013879, OTTMUSP00000023521, Transforming Protein N-Ras, v-Ras Neuroblastoma RAS Viral Oncogene Homolog)

Sign In for Pricing
View Details
Anti-ATG7 Antibody Picoband®, iFluor647 Conjugate
A00346-5-iFluor647 100 µg

Anti-ATG7 Antibody Picoband®, iFluor647 Conjugate

Sign In for Pricing
View Details
USP9YP33 3'UTR GFP Stable Cell Line
TU077960 1.0 mL

USP9YP33 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
DTX2 Mouse Monoclonal Antibody
AMM83370-01 1 Each

DTX2 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
DTX2 Mouse Monoclonal Antibody
AMM83370-02 50 µL

DTX2 Mouse Monoclonal Antibody

Sign In for Pricing
View Details