Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR4A15 Rabbit Polyclonal Antibody (HRP)

OR4A15 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OR11-118

UniProt

Q8NGL6

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human OR4A15

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KNNVTEFILLGLTQNPEGQKVLFVTFLLIYMVTIMGNLLIIVTIMASQSL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001005275

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GP2 (Glycoprotein 2) / ZAP75 (GP2/1805), 0.2mg/mL
BNUB1805-100 1x 100 µL

GP2 (Glycoprotein 2) / ZAP75 (GP2/1805), 0.2mg/mL

Sign In for Pricing
View Details
CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/3126R), CF405S conjugate, 0.1mg/mL
BNC043126-500 1x 500 µL

CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/3126R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse IgG1 (Fcγ Fragment specific), AlpSdAbs® VHH
HA710146 100 µg

Mouse IgG1 (Fcγ Fragment specific), AlpSdAbs® VHH

Sign In for Pricing
View Details
CD4 Mouse Monoclonal Antibody (SK3), CF®405M Conjugate - Biotium Choice
P001-405M-500 1x 500 µL

CD4 Mouse Monoclonal Antibody (SK3), CF®405M Conjugate - Biotium Choice

Sign In for Pricing
View Details
CD3e (CRIS-7), CF488A conjugate, 0.1mg/mL
BNC881050-500 1x 500 µL

CD3e (CRIS-7), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TOX3 (TOX3/1124), CF568 conjugate, 0.1mg/mL
BNC681124-500 1x 500 µL

TOX3 (TOX3/1124), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details