Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR4A16 Rabbit Polyclonal Antibody (FITC)

OR4A16 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

OR4A16Q, OR11-117

UniProt

Q8NH70

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR4A16

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FLLISCGVILNFLKTYSQEERHKALPTCISHIIVVALVFVPCIFMYVRPV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_001005274

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Phosphorylated Signal Transducer and Activator of Transcription 1 (PSTAT1) ELISA Kit
MBS9900747-01 48 Well

Rat Phosphorylated Signal Transducer and Activator of Transcription 1 (PSTAT1) ELISA Kit

Sign In for Pricing
View Details
Rat Phosphorylated Signal Transducer and Activator of Transcription 1 (PSTAT1) ELISA Kit
MBS9900747-02 96 Well

Rat Phosphorylated Signal Transducer and Activator of Transcription 1 (PSTAT1) ELISA Kit

Sign In for Pricing
View Details
Rat Phosphorylated Signal Transducer and Activator of Transcription 1 (PSTAT1) ELISA Kit
MBS9900747-03 5x 96 Well

Rat Phosphorylated Signal Transducer and Activator of Transcription 1 (PSTAT1) ELISA Kit

Sign In for Pricing
View Details
Rat Phosphorylated Signal Transducer and Activator of Transcription 1 (PSTAT1) ELISA Kit
MBS9900747-04 10x 96 Well

Rat Phosphorylated Signal Transducer and Activator of Transcription 1 (PSTAT1) ELISA Kit

Sign In for Pricing
View Details
Thrombin Receptor Activator for Peptide
MBS5764930 Inquire

Thrombin Receptor Activator for Peptide

Sign In for Pricing
View Details
Mug1 Antibody
CSB-PA328826LA01MO-01 50 µg

Mug1 Antibody

Sign In for Pricing
View Details