Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR4C11 Rabbit Polyclonal Antibody (HRP)

OR4C11 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OR4C11P, OR11-136

UniProt

Q6IEV9

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR4C11

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TTFPMDKMVAVFYTIGTPFLNPLIYTLRNAEVKNAMRKLWHGKIISENKG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001004700

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Macrophage Inflammatory Protein 1 Beta (MIP1b) Recombinant, Mouse
155764-01 10 µg

Macrophage Inflammatory Protein 1 Beta (MIP1b) Recombinant, Mouse

Sign In for Pricing
View Details
Macrophage Inflammatory Protein 1 Beta (MIP1b) Recombinant, Mouse
155764-02 50 µg

Macrophage Inflammatory Protein 1 Beta (MIP1b) Recombinant, Mouse

Sign In for Pricing
View Details
Macrophage Inflammatory Protein 1 Beta (MIP1b) Recombinant, Mouse
155764-03 200 µg

Macrophage Inflammatory Protein 1 Beta (MIP1b) Recombinant, Mouse

Sign In for Pricing
View Details
ANP32B Recombinant Protein (Rat)
RP190334 100 µg

ANP32B Recombinant Protein (Rat)

Sign In for Pricing
View Details
PAK4 Rabbit Polyclonal Antibody (PE-Cy5)
orb887100 100 µL

PAK4 Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details
Whatman ReZist 30mm 0.2um PTFE
FIL2516 10 / PCK

Whatman ReZist 30mm 0.2um PTFE

Sign In for Pricing
View Details