Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR4C45 Rabbit Polyclonal Antibody (HRP)

OR4C45 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

A6NMZ5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human OR4C45

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PTSFPTDKAVTVFCTLFTPMLNPLIYTLKNKEVKNVIKKLWKQIMTTDDK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Cd3g shRNA (UAS) - Lentiviral mouse Cd3g shRNA (UAS, GFP) plasmid
GTR15193402 1 Vial

Lentiviral mouse Cd3g shRNA (UAS) - Lentiviral mouse Cd3g shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
PTRF Rabbit Polyclonal Antibody (BF750)
orb2383406 100 µL

PTRF Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
Anti-SARS-CoV-2 Spike RBD (Clone 2196) Biotin
12-8479-50 50 µg

Anti-SARS-CoV-2 Spike RBD (Clone 2196) Biotin

Sign In for Pricing
View Details
Arid2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4752408 1.0 µg DNA

Arid2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Zfp281 3'UTR GFP Stable Cell Line
TU273695 1.0 mL

Zfp281 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
GABRA5 Antibody
E51A08320 100 µL

GABRA5 Antibody

Sign In for Pricing
View Details