Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR4C45 Rabbit Polyclonal Antibody (HRP)

OR4C45 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

A6NMZ5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human OR4C45

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PTSFPTDKAVTVFCTLFTPMLNPLIYTLKNKEVKNVIKKLWKQIMTTDDK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EVX1 (even-skipped Homeobox 1) (Biotin)
245854-Biotin 100 µL

EVX1 (even-skipped Homeobox 1) (Biotin)

Sign In for Pricing
View Details
CARF (CDKN2A Interacting Protein, CARF, FLJ20036) (MaxLight 550)
244233-ML550 100 µL

CARF (CDKN2A Interacting Protein, CARF, FLJ20036) (MaxLight 550)

Sign In for Pricing
View Details
Anti-Eg5 (P923) KIF11 Antibody
A01754-1 100 µL

Anti-Eg5 (P923) KIF11 Antibody

Sign In for Pricing
View Details
Chicken Coiled coil domain containing protein 74A (CCDC74A) ELISA Kit
GTR10352833 96 Well

Chicken Coiled coil domain containing protein 74A (CCDC74A) ELISA Kit

Sign In for Pricing
View Details
METTL3 Antibody - middle region
ARP39391_P050-25UL 25 µL

METTL3 Antibody - middle region

Sign In for Pricing
View Details
NFS1 Antibody
orb2682394-01 50 µL

NFS1 Antibody

Sign In for Pricing
View Details