Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR4L1 Rabbit Polyclonal Antibody (HRP)

OR4L1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OR4L2P, OR14-28

UniProt

Q8NH43

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR4L1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CIFIYVWPFSSLASNKTLAVFYTVITPLLNPSIYTLRNKKMQEAIRKLRF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001004717

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Clobetasone 17-Propionate
TRC-C583535-10MG 10 mg

Clobetasone 17-Propionate

Sign In for Pricing
View Details
Human GPR128 (ADGRG7) activation kit by CRISPRa
GA113730 1 Kit

Human GPR128 (ADGRG7) activation kit by CRISPRa

Sign In for Pricing
View Details
Human KBTBD8 activation kit by CRISPRa
GA113589 1 Kit

Human KBTBD8 activation kit by CRISPRa

Sign In for Pricing
View Details
Map2k7 Mouse Gene Knockout Kit (CRISPR)
KN309725BN 1 Kit

Map2k7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Total RNA, Ovary: bilateral
CR559425 5 µg

Tissue Total RNA, Ovary: bilateral

Sign In for Pricing
View Details
Human SUSD3 activation kit by CRISPRa
GA116443 1 Kit

Human SUSD3 activation kit by CRISPRa

Sign In for Pricing
View Details