Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR4N5 Rabbit Polyclonal Antibody (Biotin)

OR4N5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q8IXE1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR4N5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AIFIYTCPFQAFPADKVVSLFHTVIFPLMNPVIYTLRNQEVKASMRKLLS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001004724

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTF3C4 Antibody
orb20397 100 µg

GTF3C4 Antibody

Sign In for Pricing
View Details
PLOD3 Antibody
MBS9521423-01 0.04 mL

PLOD3 Antibody

Sign In for Pricing
View Details
PLOD3 Antibody
MBS9521423-02 0.1 mL

PLOD3 Antibody

Sign In for Pricing
View Details
PLOD3 Antibody
MBS9521423-03 0.2 mL

PLOD3 Antibody

Sign In for Pricing
View Details
PLOD3 Antibody
MBS9521423-04 5x 0.2 mL

PLOD3 Antibody

Sign In for Pricing
View Details
CD62L (gp90 MEL, hLHRc, L Selectin, L-Selectin, LSEL, Leukocyte Adhesion Molecule 1, LAM1, Leukocyte Endothelial Cell Adhesion Molecule 1, LECAM1, LECAM-1, Lymph Node Homing Receptor, LNHR, Lymphocyte Adhesion Molecule 1, LYAM1, PLNHR, Selectin L, SELL, T
MBS6251635-01 0.1 mL

CD62L (gp90 MEL, hLHRc, L Selectin, L-Selectin, LSEL, Leukocyte Adhesion Molecule 1, LAM1, Leukocyte Endothelial Cell Adhesion Molecule 1, LECAM1, LECAM-1, Lymph Node Homing Receptor, LNHR, Lymphocyte Adhesion Molecule 1, LYAM1, PLNHR, Selectin L, SELL, T

Sign In for Pricing
View Details