Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR5AN1 Rabbit Polyclonal Antibody (Biotin)

OR5AN1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

OR11-244

UniProt

Q8NGI8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR5AN1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LSSSSGGSSSFDRFASVFYTVVIPMLNPLIYSLRNKEIKDALKRLQKRKC

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001004729

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lymphotactin (Small Inducible Cytokine Subfamily C Member 1, SCYC1, Chemokine C Motif Ligand 1, Ltn) (MaxLight 750) discontinued
L8010-10A-ML750 100 µL

Lymphotactin (Small Inducible Cytokine Subfamily C Member 1, SCYC1, Chemokine C Motif Ligand 1, Ltn) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Anti-Mus musculus papillomavirus type 1 E7 Antibody, Dylight594 Conjugate
DZ41640-Dylight594 200 µL

Anti-Mus musculus papillomavirus type 1 E7 Antibody, Dylight594 Conjugate

Sign In for Pricing
View Details
Phospho-BAD(S57) Antibody Blocking peptide
MBS9225266-01 0.5 mg

Phospho-BAD(S57) Antibody Blocking peptide

Sign In for Pricing
View Details
Phospho-BAD(S57) Antibody Blocking peptide
MBS9225266-02 5x 0.5 mg

Phospho-BAD(S57) Antibody Blocking peptide

Sign In for Pricing
View Details
Recombinant Human Serum amyloid P component / APCS / SAP Protein (His tag)
ARP8134-01 10 µg

Recombinant Human Serum amyloid P component / APCS / SAP Protein (His tag)

Sign In for Pricing
View Details
Recombinant Human Serum amyloid P component / APCS / SAP Protein (His tag)
ARP8134-02 50 µg

Recombinant Human Serum amyloid P component / APCS / SAP Protein (His tag)

Sign In for Pricing
View Details