Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR5B12 Rabbit Polyclonal Antibody (Biotin)

OR5B12 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

OR5B16, OST743, OR5B12P, OR11-241

UniProt

Q96R08

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR5B12

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EMVIFFVVGFNDLFSILVILISYLFIFITIMKMRSPEGRQKAFSTCASHL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001004733

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium hydroxide solution 25 % p.A.
LC-10792.2 5 L

Sodium hydroxide solution 25 % p.A.

Sign In for Pricing
View Details
MRPL2 3'UTR Luciferase Stable Cell Line
TU014535 1.0 mL

MRPL2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Pyrobaculum islandicum DNA/RNA-binding protein Alba (albA)
MBS1126069-01 0.02 mg (E-Coli)

Recombinant Pyrobaculum islandicum DNA/RNA-binding protein Alba (albA)

Sign In for Pricing
View Details
Recombinant Pyrobaculum islandicum DNA/RNA-binding protein Alba (albA)
MBS1126069-02 0.1 mg (E-Coli)

Recombinant Pyrobaculum islandicum DNA/RNA-binding protein Alba (albA)

Sign In for Pricing
View Details
Recombinant Pyrobaculum islandicum DNA/RNA-binding protein Alba (albA)
MBS1126069-03 0.02 mg (Yeast)

Recombinant Pyrobaculum islandicum DNA/RNA-binding protein Alba (albA)

Sign In for Pricing
View Details
Recombinant Pyrobaculum islandicum DNA/RNA-binding protein Alba (albA)
MBS1126069-04 0.1 mg (Yeast)

Recombinant Pyrobaculum islandicum DNA/RNA-binding protein Alba (albA)

Sign In for Pricing
View Details