Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR5L1 Rabbit Polyclonal Antibody (FITC)

OR5L1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

OST262, OR11-151

UniProt

Q8NGL2

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human OR5L1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SSSYALDTDKMASVFYTLVIPSLNPLIYSLRNKEVKEALRQTWSRFHCPG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001004738.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Egf, 977-1029aa, Mouse, His-tag, E Coli (Bioactivity Validated)
MBS206779-01 0.005 mg

Egf, 977-1029aa, Mouse, His-tag, E Coli (Bioactivity Validated)

Sign In for Pricing
View Details
Egf, 977-1029aa, Mouse, His-tag, E Coli (Bioactivity Validated)
MBS206779-02 0.02 mg

Egf, 977-1029aa, Mouse, His-tag, E Coli (Bioactivity Validated)

Sign In for Pricing
View Details
Egf, 977-1029aa, Mouse, His-tag, E Coli (Bioactivity Validated)
MBS206779-03 5x 0.005 mg

Egf, 977-1029aa, Mouse, His-tag, E Coli (Bioactivity Validated)

Sign In for Pricing
View Details
Egf, 977-1029aa, Mouse, His-tag, E Coli (Bioactivity Validated)
MBS206779-04 5x 0.02 mg

Egf, 977-1029aa, Mouse, His-tag, E Coli (Bioactivity Validated)

Sign In for Pricing
View Details
Vericiguat Amide Impurity
CS-O-56586 1 Each

Vericiguat Amide Impurity

Sign In for Pricing
View Details
ISPD (CRPPA) (NM_001101417) Human Tagged ORF Clone Lentiviral Particle
RC225626L3V 200 µL

ISPD (CRPPA) (NM_001101417) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details