Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR5D13 Rabbit Polyclonal Antibody (HRP)

OR5D13 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q8NGL4

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR5D13

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YCVPNPKTSSLIVTVASVFYTVAIPMLNPLIYSLRNKDINNMFEKLVVTK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_001001967

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nylon Wool Fiber, Syringe (Gamma Irradiated)
21759-1 1 Pkg

Nylon Wool Fiber, Syringe (Gamma Irradiated)

Sign In for Pricing
View Details
ASIP Protein Vector (Rat) (pPM-C-His)
PV254937 500 ng

ASIP Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Ube2o (NM_173755) Mouse Tagged Lenti ORF Clone
MR220692L3 10 µg

Ube2o (NM_173755) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
HERC4 Knockout HT29 Polyclonal Cells
ARG33336 1 Million

HERC4 Knockout HT29 Polyclonal Cells

Sign In for Pricing
View Details
Lentiviral human NTM shRNA (UAS) - Lentiviral human NTM shRNA (UAS) plasmid
GTR15118591 1 Vial

Lentiviral human NTM shRNA (UAS) - Lentiviral human NTM shRNA (UAS) plasmid

Sign In for Pricing
View Details
Goat Mouse Lambda Light Chain Antibody
orb1519048 1 mg

Goat Mouse Lambda Light Chain Antibody

Sign In for Pricing
View Details