Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR8D1 Rabbit Polyclonal Antibody (Biotin)

OR8D1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

JCG9, OR8D3, OST004, PDJ9J14

UniProt

Q8WZ84

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR8D1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FFGSITFMYFKPPSSNSLDQEKVSSVFYTTVIPMLNPLIYSLRNKDVKKA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001002917

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IL-12B/IL-12 p40 enzyme-linked immunoassay kit
EH0098 96 Tests

Human IL-12B/IL-12 p40 enzyme-linked immunoassay kit

Sign In for Pricing
View Details
LRRC17 (NM_001031692) Human Over-expression Lysate
E45H04607-2 20 µg

LRRC17 (NM_001031692) Human Over-expression Lysate

Sign In for Pricing
View Details
Cyp2r1 3'UTR GFP Stable Cell Line
TU253082 1.0 mL

Cyp2r1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
SRA1 (NM_001035235) Human Tagged Lenti ORF Clone
RC220899L4 10 µg

SRA1 (NM_001035235) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse CXCL2 Antibody Pair Set
E-KAB-0319 50 µL & 100 µg

Mouse CXCL2 Antibody Pair Set

Sign In for Pricing
View Details
Nectin 2 (NECTIN2) (NM_002856) Human Tagged ORF Clone Lentiviral Particle
RC200286L4V 200 µL

Nectin 2 (NECTIN2) (NM_002856) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details