Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR6C6 Rabbit Polyclonal Antibody (Biotin)

OR6C6 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

A6NF89

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR6C6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VSMTYGSCIFMYIKPSAKERVTVSKGVALLYTSIAPLLNPFIYTLRNQQV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001005493

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-human Sulfite oxidase, mitochondrial polyclonal Antibody, FITC
MBS1488397-01 0.05 mg

Rabbit anti-human Sulfite oxidase, mitochondrial polyclonal Antibody, FITC

Sign In for Pricing
View Details
Rabbit anti-human Sulfite oxidase, mitochondrial polyclonal Antibody, FITC
MBS1488397-02 0.1 mg

Rabbit anti-human Sulfite oxidase, mitochondrial polyclonal Antibody, FITC

Sign In for Pricing
View Details
Rabbit anti-human Sulfite oxidase, mitochondrial polyclonal Antibody, FITC
MBS1488397-03 5x 0.1 mg

Rabbit anti-human Sulfite oxidase, mitochondrial polyclonal Antibody, FITC

Sign In for Pricing
View Details
Goat 5-hydroxytryptamine receptor 2A (HTR2A) ELISA Kit
MBS7205962-01 48 Well

Goat 5-hydroxytryptamine receptor 2A (HTR2A) ELISA Kit

Sign In for Pricing
View Details
Goat 5-hydroxytryptamine receptor 2A (HTR2A) ELISA Kit
MBS7205962-02 96 Well

Goat 5-hydroxytryptamine receptor 2A (HTR2A) ELISA Kit

Sign In for Pricing
View Details
Goat 5-hydroxytryptamine receptor 2A (HTR2A) ELISA Kit
MBS7205962-03 5x 96 Well

Goat 5-hydroxytryptamine receptor 2A (HTR2A) ELISA Kit

Sign In for Pricing
View Details