Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR6K2 Rabbit Polyclonal Antibody (HRP)

OR6K2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OR1-17

UniProt

Q8NGY2

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR6K2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AIALAFAVLSPFFNPIIYSLRNKEIKEAIKKHIGQAKIFFSVRPGTSSKI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001005279

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human anti-Mi2-antibody ELISA Kit
NB-E10454-01 96 Well

Human anti-Mi2-antibody ELISA Kit

Sign In for Pricing
View Details
Human anti-Mi2-antibody ELISA Kit
NB-E10454-02 96 Well

Human anti-Mi2-antibody ELISA Kit

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica Probable protein phosphatase 2C 67 (Os09g0314400, LOC_Os09g14540)
MBS1426588-01 0.02 mg (E-Coli)

Recombinant Oryza sativa subsp. japonica Probable protein phosphatase 2C 67 (Os09g0314400, LOC_Os09g14540)

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica Probable protein phosphatase 2C 67 (Os09g0314400, LOC_Os09g14540)
MBS1426588-02 0.02 mg (Yeast)

Recombinant Oryza sativa subsp. japonica Probable protein phosphatase 2C 67 (Os09g0314400, LOC_Os09g14540)

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica Probable protein phosphatase 2C 67 (Os09g0314400, LOC_Os09g14540)
MBS1426588-03 0.1 mg (E-Coli)

Recombinant Oryza sativa subsp. japonica Probable protein phosphatase 2C 67 (Os09g0314400, LOC_Os09g14540)

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica Probable protein phosphatase 2C 67 (Os09g0314400, LOC_Os09g14540)
MBS1426588-04 0.1 mg (Yeast)

Recombinant Oryza sativa subsp. japonica Probable protein phosphatase 2C 67 (Os09g0314400, LOC_Os09g14540)

Sign In for Pricing
View Details