Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR6N2 Rabbit Polyclonal Antibody (Biotin)

OR6N2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

OR1-23

UniProt

Q8NGY6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR6N2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KSYSLTLDRTLAIVYSVLTPMVNPIIYSLRNKEIIKAIKRTIFQKGDKAS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_001005278

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APPL1 (DCC-interacting Protein 13-alpha, Dip13-alpha, Adapter Protein Containing PH Domain, PTB Domain and Leucine Zipper Motif 1, APPL, DIP13A, KIAA1428) (AP)
MBS6370177-01 0.1 mL

APPL1 (DCC-interacting Protein 13-alpha, Dip13-alpha, Adapter Protein Containing PH Domain, PTB Domain and Leucine Zipper Motif 1, APPL, DIP13A, KIAA1428) (AP)

Sign In for Pricing
View Details
APPL1 (DCC-interacting Protein 13-alpha, Dip13-alpha, Adapter Protein Containing PH Domain, PTB Domain and Leucine Zipper Motif 1, APPL, DIP13A, KIAA1428) (AP)
MBS6370177-02 5x 0.1 mL

APPL1 (DCC-interacting Protein 13-alpha, Dip13-alpha, Adapter Protein Containing PH Domain, PTB Domain and Leucine Zipper Motif 1, APPL, DIP13A, KIAA1428) (AP)

Sign In for Pricing
View Details
CD14, CT (CD14, Monocyte differentiation antigen CD14, Myeloid cell-specific leucine-rich glycoprotein, CD14, Monocyte differentiation antigen CD14, urinary form, Monocyte differentiation antigen CD14, membrane-bound form) (FITC) discontinued
033459-FITC 200 µL

CD14, CT (CD14, Monocyte differentiation antigen CD14, Myeloid cell-specific leucine-rich glycoprotein, CD14, Monocyte differentiation antigen CD14, urinary form, Monocyte differentiation antigen CD14, membrane-bound form) (FITC) discontinued

Sign In for Pricing
View Details
STL1 Antibody
orb797402 2 mg

STL1 Antibody

Sign In for Pricing
View Details
InVivoMAb Mouse CD19 & CD8 Bispecific Antibody
orb3155197-01 50 µg

InVivoMAb Mouse CD19 & CD8 Bispecific Antibody

Sign In for Pricing
View Details
InVivoMAb Mouse CD19 & CD8 Bispecific Antibody
orb3155197-02 100 µg

InVivoMAb Mouse CD19 & CD8 Bispecific Antibody

Sign In for Pricing
View Details