Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR7A17 Rabbit Polyclonal Antibody (HRP)

OR7A17 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HTPCRX19, BC85395_4

UniProt

O14581

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR7A17

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ASHLSVVSLFCCTGLGVYLTSAATHNSHTSATASVMYTVATPMLNPFIYS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_112163

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FGF19 ELISA Kit (DIY Antibody Pairs)
orb1098231 5 Plate

Human FGF19 ELISA Kit (DIY Antibody Pairs)

Sign In for Pricing
View Details
Accuris High Fidelity DNA Polymerase, sample, 20 units
PR1000-HF-S 1 Each

Accuris High Fidelity DNA Polymerase, sample, 20 units

Sign In for Pricing
View Details
CDH1, CT (E-Cadherin, Epithelial Cadherin, Uvomorulin, Cadherin-1, CAM 120/80, CD324, UVO)
MBS643588-01 0.2 mL

CDH1, CT (E-Cadherin, Epithelial Cadherin, Uvomorulin, Cadherin-1, CAM 120/80, CD324, UVO)

Sign In for Pricing
View Details
CDH1, CT (E-Cadherin, Epithelial Cadherin, Uvomorulin, Cadherin-1, CAM 120/80, CD324, UVO)
MBS643588-02 5x 0.2 mL

CDH1, CT (E-Cadherin, Epithelial Cadherin, Uvomorulin, Cadherin-1, CAM 120/80, CD324, UVO)

Sign In for Pricing
View Details
Recombinant Conus ventricosus Conotoxin VnMRCL-022
MBS7098052-01 0.05 mg (E-Coli)

Recombinant Conus ventricosus Conotoxin VnMRCL-022

Sign In for Pricing
View Details
Recombinant Conus ventricosus Conotoxin VnMRCL-022
MBS7098052-02 0.2 mg (E-Coli)

Recombinant Conus ventricosus Conotoxin VnMRCL-022

Sign In for Pricing
View Details