Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR7G2 Rabbit Polyclonal Antibody (HRP)

OR7G2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OR19-6, OST260

UniProt

Q8NG99

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR7G2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LGVYISSVVTDSPRKTAVASVMYSVFPQMVNPFIYSLRNKDMKGTLRKFI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRTAP6-1 (NM_181602) Human Over-expression Lysate
E45H15742-2 20 µg

KRTAP6-1 (NM_181602) Human Over-expression Lysate

Sign In for Pricing
View Details
KBTBD2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1115308 1.0 µg DNA

KBTBD2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
ABCA12 Human shRNA Lentiviral Particle (Locus ID 26154)
TL306928V 500 µL Each

ABCA12 Human shRNA Lentiviral Particle (Locus ID 26154)

Sign In for Pricing
View Details
Lentiviral human IL11RA shRNA (UAS) - Lentiviral human IL11RA shRNA (UAS, GFP) (100)
GTR15337788 1 Vial

Lentiviral human IL11RA shRNA (UAS) - Lentiviral human IL11RA shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
CXCL9 Protein, Mouse, Recombinant (His)
TMPJ-00884-01 5 µg

CXCL9 Protein, Mouse, Recombinant (His)

Sign In for Pricing
View Details
CXCL9 Protein, Mouse, Recombinant (His)
TMPJ-00884-02 10 µg

CXCL9 Protein, Mouse, Recombinant (His)

Sign In for Pricing
View Details