Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR5M10 Rabbit Polyclonal Antibody (HRP)

OR5M10 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OR11-207

UniProt

Q6IEU7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human OR5M10

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NGLSQTLLTFHLSFCGSLEINHFYCADPPLIMLACSDTRVKKMAMFVVAG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001004741

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LACTB CRISPR Knock Out 293T Cell Line (Human)
26260141 1x 10^6 Cells / 1.0 mL

LACTB CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Recombinant Mycobacterium Abscessus MAB_0027c Protein (aa 1-299)
VAng-Yyj5450-1mgEcoli 1 mg (E. coli)

Recombinant Mycobacterium Abscessus MAB_0027c Protein (aa 1-299)

Sign In for Pricing
View Details
FECH ELISA Kit (Mouse) (OKEH05255)
OKEH05255 96 Well

FECH ELISA Kit (Mouse) (OKEH05255)

Sign In for Pricing
View Details
Human Longevity Assurance Homolog 2 (LASS2) ELISA Kit
DLR-LASS2-Hu-01 48 Tests

Human Longevity Assurance Homolog 2 (LASS2) ELISA Kit

Sign In for Pricing
View Details
Human Longevity Assurance Homolog 2 (LASS2) ELISA Kit
DLR-LASS2-Hu-02 96 Tests

Human Longevity Assurance Homolog 2 (LASS2) ELISA Kit

Sign In for Pricing
View Details
Polyclonal Antibody to Discs, Large Homolog 4 (DLG4)
TRV-0057875-01 20 µL

Polyclonal Antibody to Discs, Large Homolog 4 (DLG4)

Sign In for Pricing
View Details