Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR5M10 Rabbit Polyclonal Antibody (FITC)

OR5M10 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

OR11-207

UniProt

Q6IEU7

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR5M10

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SAEGRHKAFSTCASHLTIVTLFYGTLFCMYVRPPSEKSVEESKIIAVFYT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001004741

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLEKHH1, CT (PLEKHH1, KIAA1200, Pleckstrin homology domain-containing family H member 1) (Azide free) (HRP)
MBS6334898-01 0.2 mL

PLEKHH1, CT (PLEKHH1, KIAA1200, Pleckstrin homology domain-containing family H member 1) (Azide free) (HRP)

Sign In for Pricing
View Details
PLEKHH1, CT (PLEKHH1, KIAA1200, Pleckstrin homology domain-containing family H member 1) (Azide free) (HRP)
MBS6334898-02 5x 0.2 mL

PLEKHH1, CT (PLEKHH1, KIAA1200, Pleckstrin homology domain-containing family H member 1) (Azide free) (HRP)

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) GRXC14 Polyclonal Antibody
MBS9009425 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) GRXC14 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Pseudomonas Aeruginosa PSPA7_0505 Protein (aa 1-189)
VAng-Cr0300-1mgEcoli 1 mg (E. coli)

Recombinant Pseudomonas Aeruginosa PSPA7_0505 Protein (aa 1-189)

Sign In for Pricing
View Details
WDR13 (WD Repeat-containing Protein 13, MG21, DKFZp779C2057, FLJ20563) (MaxLight 550)
138489-ML550 100 µL

WDR13 (WD Repeat-containing Protein 13, MG21, DKFZp779C2057, FLJ20563) (MaxLight 550)

Sign In for Pricing
View Details
Vitamin D Binding protein (GC) Mouse Monoclonal Antibody [Clone 8C5]
E45M18889V-2 50 µL

Vitamin D Binding protein (GC) Mouse Monoclonal Antibody [Clone 8C5]

Sign In for Pricing
View Details