Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR5M10 Rabbit Polyclonal Antibody (FITC)

OR5M10 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

OR11-207

UniProt

Q6IEU7

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR5M10

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SAEGRHKAFSTCASHLTIVTLFYGTLFCMYVRPPSEKSVEESKIIAVFYT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001004741

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDK2 Rabbit Monoclonal Antibody [Clone ID: R05-2C4]
TA421702 100 µL

CDK2 Rabbit Monoclonal Antibody [Clone ID: R05-2C4]

Sign In for Pricing
View Details
Complement C1q and tumor necrosis factor-related protein 9A (C1QTNF9) Antibody (HRP)
abx341355-01 50 µL

Complement C1q and tumor necrosis factor-related protein 9A (C1QTNF9) Antibody (HRP)

Sign In for Pricing
View Details
Complement C1q and tumor necrosis factor-related protein 9A (C1QTNF9) Antibody (HRP)
abx341355-02 100 µL

Complement C1q and tumor necrosis factor-related protein 9A (C1QTNF9) Antibody (HRP)

Sign In for Pricing
View Details
Complement C1q and tumor necrosis factor-related protein 9A (C1QTNF9) Antibody (HRP)
abx341355-03 200 µL

Complement C1q and tumor necrosis factor-related protein 9A (C1QTNF9) Antibody (HRP)

Sign In for Pricing
View Details
Complement C1q and tumor necrosis factor-related protein 9A (C1QTNF9) Antibody (HRP)
abx341355-04 1 mL

Complement C1q and tumor necrosis factor-related protein 9A (C1QTNF9) Antibody (HRP)

Sign In for Pricing
View Details
OTX1 + OTX2 Polyclonal Antibody, Biotin Conjugated
bs-11958R-Biotin-01 20 µL

OTX1 + OTX2 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details