Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR5R1 Rabbit Polyclonal Antibody (FITC)

OR5R1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

OR5R1, OR5R1P, OR11-185

UniProt

Q8NH85

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR5R1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: STCGSHMVTVTIFYGTLIFMYLQPKSNHSLDTDKMASVFYTVVIPMLNPL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001004744

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Znfx1 (NM_001291162) Mouse Tagged ORF Clone
MR231519 10 µg

Znfx1 (NM_001291162) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Goat anti Mouse IgG2 (subclass specific), conjugated with Horseradish peroxidase
MBS571924-01 1 mL

Goat anti Mouse IgG2 (subclass specific), conjugated with Horseradish peroxidase

Sign In for Pricing
View Details
Goat anti Mouse IgG2 (subclass specific), conjugated with Horseradish peroxidase
MBS571924-02 5x 1 mL

Goat anti Mouse IgG2 (subclass specific), conjugated with Horseradish peroxidase

Sign In for Pricing
View Details
PARD6G Protein Lysate (Human) with C-Ha Tag
36010031 100 µg

PARD6G Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
KCNB2 Protein Vector (Human) (pPB-C-His)
PV088422 500 ng

KCNB2 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Rabbit anti-Gossypium hirsutum (Upland cotton)(Gossypium mexicanum) YCF4 Polyclonal Antibody
MBS7192550 Inquire

Rabbit anti-Gossypium hirsutum (Upland cotton)(Gossypium mexicanum) YCF4 Polyclonal Antibody

Sign In for Pricing
View Details