Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR5R1 Rabbit Polyclonal Antibody (HRP)

OR5R1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OR5R1, OR5R1P, OR11-185

UniProt

Q8NH85

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR5R1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: STCGSHMVTVTIFYGTLIFMYLQPKSNHSLDTDKMASVFYTVVIPMLNPL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001004744

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Treponema Pallidum flhF Protein (aa 1-437)
VAng-Cr1508-500gEcoli 500 µg (E. coli)

Recombinant Treponema Pallidum flhF Protein (aa 1-437)

Sign In for Pricing
View Details
CD326/EPCAM Human Monoclonal Antibody
orb2977241-01 100 µg

CD326/EPCAM Human Monoclonal Antibody

Sign In for Pricing
View Details
CD326/EPCAM Human Monoclonal Antibody
orb2977241-02 1 mg

CD326/EPCAM Human Monoclonal Antibody

Sign In for Pricing
View Details
Odf4 (BC060992) Mouse Tagged ORF Clone Lentiviral Particle
MR201555L3V 200 µL

Odf4 (BC060992) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Sodium lauryl sulfoacetate
BUP11043-01 25 mg

Sodium lauryl sulfoacetate

Sign In for Pricing
View Details
Sodium lauryl sulfoacetate
BUP11043-02 50 mg

Sodium lauryl sulfoacetate

Sign In for Pricing
View Details