Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR8D1 Rabbit Polyclonal Antibody (Biotin)

OR8D1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

JCG9, OR8D3, OST004, PDJ9J14

UniProt

Q8WZ84

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR8D1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SKAFGTCSSHLMAVVIFFGSITFMYFKPPSSNSLDQEKVSSVFYTTVIPM

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_001002917

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRRX1, CT (PRRX1, PMX1, Paired mesoderm homeobox protein 1, Homeobox protein PHOX1, Paired-related homeobox protein 1) (AP)
MBS6337864-01 0.2 mL

PRRX1, CT (PRRX1, PMX1, Paired mesoderm homeobox protein 1, Homeobox protein PHOX1, Paired-related homeobox protein 1) (AP)

Sign In for Pricing
View Details
PRRX1, CT (PRRX1, PMX1, Paired mesoderm homeobox protein 1, Homeobox protein PHOX1, Paired-related homeobox protein 1) (AP)
MBS6337864-02 5x 0.2 mL

PRRX1, CT (PRRX1, PMX1, Paired mesoderm homeobox protein 1, Homeobox protein PHOX1, Paired-related homeobox protein 1) (AP)

Sign In for Pricing
View Details
SERF1B Protein Vector (Human) (pPB-C-His)
PV128674 500 ng

SERF1B Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Dematin Antibody Blocking Peptide
orb1507624 500 µg

Dematin Antibody Blocking Peptide

Sign In for Pricing
View Details
Human PAI-1 ELISA Kit
orb1658080 96 Tests

Human PAI-1 ELISA Kit

Sign In for Pricing
View Details
HDAC8 Knockout SKOV3 Polyclonal Cells
ARG36728 1 Million

HDAC8 Knockout SKOV3 Polyclonal Cells

Sign In for Pricing
View Details