Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR8H1 Rabbit Polyclonal Antibody (HRP)

OR8H1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OR11-180

UniProt

Q8NGG4

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR8H1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RKSYSLGRDQVASVFYTIVIPMLNPLIYSLRNKEVKNALIRVMQRRQDSR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Yeast

Tested Applications

WB

NCBI Accession Number

NP_001005199

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BEND5 Rabbit Polyclonal Antibody
orb3069835-01 30 µL

BEND5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BEND5 Rabbit Polyclonal Antibody
orb3069835-02 50 µL

BEND5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BEND5 Rabbit Polyclonal Antibody
orb3069835-03 100 µL

BEND5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BEND5 Rabbit Polyclonal Antibody
orb3069835-04 200 µL

BEND5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Scamp4 shRNA (UAS) - Lentiviral mouse Scamp4 shRNA (UAS) plasmid
GTR15188083 1 Vial

Lentiviral mouse Scamp4 shRNA (UAS) - Lentiviral mouse Scamp4 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Epcam (Epithelial Cell Adhesion Molecule, Ep-CAM, Epithelial GlycoProtein 314, EGP314, mEGP314, Protein 289A, Tumor-Associated Calcium signal Transducer 1, CD326, Epcam, Tacstd1) (MaxLight 550)
MBS6455795-01 0.1 mL

Epcam (Epithelial Cell Adhesion Molecule, Ep-CAM, Epithelial GlycoProtein 314, EGP314, mEGP314, Protein 289A, Tumor-Associated Calcium signal Transducer 1, CD326, Epcam, Tacstd1) (MaxLight 550)

Sign In for Pricing
View Details