Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR8U9 Rabbit Polyclonal Antibody (Biotin)

OR8U9 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

P0C7N5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR8U9

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FMYLQPSSSHALDTDKMASVFYTVIIPMLNPLIYSLQNKEVKEALKKIII

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001013375

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Zfand5 shRNA (UAS) - Lentiviral mouse Zfand5 shRNA (UAS, RFP) plasmid
GTR15261205 1 Vial

Lentiviral mouse Zfand5 shRNA (UAS) - Lentiviral mouse Zfand5 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
REEP5, CT (REEP5, C5orf18, DP1, TB2, Receptor expression-enhancing protein 5, Polyposis locus protein 1, Protein TB2) (MaxLight 405)
MBS6341218-01 0.1 mL

REEP5, CT (REEP5, C5orf18, DP1, TB2, Receptor expression-enhancing protein 5, Polyposis locus protein 1, Protein TB2) (MaxLight 405)

Sign In for Pricing
View Details
REEP5, CT (REEP5, C5orf18, DP1, TB2, Receptor expression-enhancing protein 5, Polyposis locus protein 1, Protein TB2) (MaxLight 405)
MBS6341218-02 5x 0.1 mL

REEP5, CT (REEP5, C5orf18, DP1, TB2, Receptor expression-enhancing protein 5, Polyposis locus protein 1, Protein TB2) (MaxLight 405)

Sign In for Pricing
View Details
Lentiviral human JCHAIN sgRNA gene knockout kit - Lentiviral human JCHAIN sgRNA gene knockout kit (25)
GTR15387252 1 Vial

Lentiviral human JCHAIN sgRNA gene knockout kit - Lentiviral human JCHAIN sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
ANKRD34C, CT (ANKRD34C, Ankyrin repeat domain-containing protein 34C) (MaxLight 750) discontinued
031895-ML750 100 µL

ANKRD34C, CT (ANKRD34C, Ankyrin repeat domain-containing protein 34C) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Secretagogin (SCGN, SECRET, SEGN, CALBL, DJ501N12.8, Setagin)
MBS645622-01 0.1 mg

Secretagogin (SCGN, SECRET, SEGN, CALBL, DJ501N12.8, Setagin)

Sign In for Pricing
View Details