Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR8U8 Rabbit Polyclonal Antibody (FITC)

OR8U8 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

P0C7N1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR8U8

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SLDADKMASVFYTVIIPMLNPLIYSLRNKDVKDALKKVIINRNHAFIFLK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001013374

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CARD11 Human Over-expression Lysate
orb1376555 20 µg

CARD11 Human Over-expression Lysate

Sign In for Pricing
View Details
Zic2 Polyclonal Antibody, PE-Cy5 Conjugated
bs-11610R-PE-Cy5 100 µL

Zic2 Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
PE/Fluor 594 Rat IgG2a, kappa Isotype Control [2A3]
MBS2572039-01 20 Tests

PE/Fluor 594 Rat IgG2a, kappa Isotype Control [2A3]

Sign In for Pricing
View Details
PE/Fluor 594 Rat IgG2a, kappa Isotype Control [2A3]
MBS2572039-02 100 Tests

PE/Fluor 594 Rat IgG2a, kappa Isotype Control [2A3]

Sign In for Pricing
View Details
PE/Fluor 594 Rat IgG2a, kappa Isotype Control [2A3]
MBS2572039-03 2x 100 Tests

PE/Fluor 594 Rat IgG2a, kappa Isotype Control [2A3]

Sign In for Pricing
View Details
PE/Fluor 594 Rat IgG2a, kappa Isotype Control [2A3]
MBS2572039-04 10x 100 Tests

PE/Fluor 594 Rat IgG2a, kappa Isotype Control [2A3]

Sign In for Pricing
View Details