Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR9A2 Rabbit Polyclonal Antibody (HRP)

OR9A2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q8NGT5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR9A2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VKPKQTQGVEYNKIVSLLVSVLTPFLNPFIFTLRNDKVKEALRDGMKRCC

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001001658

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1564171 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
39355066 1.0 µg DNA

RGD1564171 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
ENMD-2076 L-(+)-Tartaric acid
A4129-5 5 mg

ENMD-2076 L-(+)-Tartaric acid

Sign In for Pricing
View Details
PSCD2 (CYTH2, ARNO, PSCD2L, Cytohesin-2, ARF Exchange Factor, ARF Nucleotide-binding Site Opener, PH, SEC7 and Coiled-coil Domain-containing Protein 2, Protein ARNO) (MaxLight 650)
MBS6224065-01 0.1 mL

PSCD2 (CYTH2, ARNO, PSCD2L, Cytohesin-2, ARF Exchange Factor, ARF Nucleotide-binding Site Opener, PH, SEC7 and Coiled-coil Domain-containing Protein 2, Protein ARNO) (MaxLight 650)

Sign In for Pricing
View Details
PSCD2 (CYTH2, ARNO, PSCD2L, Cytohesin-2, ARF Exchange Factor, ARF Nucleotide-binding Site Opener, PH, SEC7 and Coiled-coil Domain-containing Protein 2, Protein ARNO) (MaxLight 650)
MBS6224065-02 5x 0.1 mL

PSCD2 (CYTH2, ARNO, PSCD2L, Cytohesin-2, ARF Exchange Factor, ARF Nucleotide-binding Site Opener, PH, SEC7 and Coiled-coil Domain-containing Protein 2, Protein ARNO) (MaxLight 650)

Sign In for Pricing
View Details
DMRTB1 Protein Vector (Mouse) (pPM-C-HA)
18321024 500 ng

DMRTB1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse Monoclonal GADD45G Antibody (OTI2F12) [DyLight 650]
NBP2-71646C 0.1 mL

Mouse Monoclonal GADD45G Antibody (OTI2F12) [DyLight 650]

Sign In for Pricing
View Details