Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR9I1 Rabbit Polyclonal Antibody (HRP)

OR9I1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OR11-228

UniProt

Q8NGQ6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR9I1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VKSSGGRAKTFSTCASHITAVALFFGALIFMYLQSGSGKSLEEDKVVSVF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001005211

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Plant Hepatocyte Nuclear Factor 1 Beta (HNF1B) ELISA Kit
MBS9371606 Inquire

Plant Hepatocyte Nuclear Factor 1 Beta (HNF1B) ELISA Kit

Sign In for Pricing
View Details
Human NEFM Pre-designed siRNA Set A
SI010429A 1 Each

Human NEFM Pre-designed siRNA Set A

Sign In for Pricing
View Details
NFKB Activating Protein (NKAP) Magnetic Fluorescence Assay Kit
MBS2160815-01 96 Tests

NFKB Activating Protein (NKAP) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
NFKB Activating Protein (NKAP) Magnetic Fluorescence Assay Kit
MBS2160815-02 5x 96 Tests

NFKB Activating Protein (NKAP) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
NFKB Activating Protein (NKAP) Magnetic Fluorescence Assay Kit
MBS2160815-03 10x 96 Tests

NFKB Activating Protein (NKAP) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
IL-1F10 CRISPR/Cas9 KO Plasmid (h)
sc-410201 20 µg

IL-1F10 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details