Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR10A2 Rabbit Polyclonal Antibody (Biotin)

OR10A2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

OST363, OR10A2P, OR11-82, OR11-86

UniProt

Q9H208

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR10A2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YTHIAAAILKIPSAKGKNKAFSTCSSHLLVVSLFYISLSLTYFRPKSNNS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001004460

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HMGB2 (High-Mobility Group Box 2, HMG2) (AP) discontinued
247144-AP 100 µL

HMGB2 (High-Mobility Group Box 2, HMG2) (AP) discontinued

Sign In for Pricing
View Details
LMF2 Knockout A549 Polyclonal Cells
ARG10960 1 Million

LMF2 Knockout A549 Polyclonal Cells

Sign In for Pricing
View Details
Phospho-HER2 (Tyr1112) BioAssayTM ELISA Kit
473095 2x 96 Tests

Phospho-HER2 (Tyr1112) BioAssayTM ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Hlf shRNA (UAS) - Lentiviral mouse Hlf shRNA (UAS, iRFP) plasmid
GTR15237964 1 Vial

Lentiviral mouse Hlf shRNA (UAS) - Lentiviral mouse Hlf shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
CREB1 Recombinant Protein (Mouse)
RP125927 100 µg

CREB1 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Total RNA - Human Adult Normal Tissue: Brain: Cerebellum
R1234039-50 50 µg

Total RNA - Human Adult Normal Tissue: Brain: Cerebellum

Sign In for Pricing
View Details