Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR11H12 Rabbit Polyclonal Antibody (HRP)

OR11H12 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

B2RN74

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human OR11H12

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YAFIFITVMKMPSTGGRKKAFSTCASHLTAITIFHGTILFLYCVPNSKSS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001013372.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CNR1 3'UTR GFP Stable Cell Line
TU054714 1.0 mL

CNR1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Mouse Anti-Human IgG2 Fc-BIOT
9060-08 0.5 mg

Mouse Anti-Human IgG2 Fc-BIOT

Sign In for Pricing
View Details
CD45 (Leukocyte Common Antigen, LCA, Ly-5 T200) (PE)
C2399-14E 100 Tests

CD45 (Leukocyte Common Antigen, LCA, Ly-5 T200) (PE)

Sign In for Pricing
View Details
Human Lung Cancer (5 slides/pack, single section/slide)
S-HuCAT206 1 unit

Human Lung Cancer (5 slides/pack, single section/slide)

Sign In for Pricing
View Details
Human ZNF583 Protein Lysate
MBS8430318-01 0.02 mg

Human ZNF583 Protein Lysate

Sign In for Pricing
View Details
Human ZNF583 Protein Lysate
MBS8430318-02 5x 0.02 mg

Human ZNF583 Protein Lysate

Sign In for Pricing
View Details