Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR10C1 Rabbit Polyclonal Antibody (FITC)

OR10C1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

OR10C2, OR6-31, OR10C1P, hs6M1-17

UniProt

Q96KK4

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR10C1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PNTIPQFFCEIQPVLQLVCGDTSLNELQIILATALLILCPFGLILGSYGR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_039229

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit sIL-6R ELISA Kit
ERTS0267 96 Tests

Rabbit sIL-6R ELISA Kit

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Serine/Threonine Kinase 11 (STK11)
MBS2096341-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Serine/Threonine Kinase 11 (STK11)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Serine/Threonine Kinase 11 (STK11)
MBS2096341-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Serine/Threonine Kinase 11 (STK11)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Serine/Threonine Kinase 11 (STK11)
MBS2096341-03 0.5 mL

Biotin-Linked Polyclonal Antibody to Serine/Threonine Kinase 11 (STK11)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Serine/Threonine Kinase 11 (STK11)
MBS2096341-04 1 mL

Biotin-Linked Polyclonal Antibody to Serine/Threonine Kinase 11 (STK11)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Serine/Threonine Kinase 11 (STK11)
MBS2096341-05 5 mL

Biotin-Linked Polyclonal Antibody to Serine/Threonine Kinase 11 (STK11)

Sign In for Pricing
View Details