Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR10C1 Rabbit Polyclonal Antibody (HRP)

OR10C1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OR10C2, OR6-31, OR10C1P, hs6M1-17

UniProt

Q96KK4

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR10C1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PNTIPQFFCEIQPVLQLVCGDTSLNELQIILATALLILCPFGLILGSYGR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_039229

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human TGFBR1/ALK-5 Protein (aa 200-503, His & GST Tag)
PKSH030413 50 µg

Recombinant Human TGFBR1/ALK-5 Protein (aa 200-503, His & GST Tag)

Sign In for Pricing
View Details
Mouse Plk3 activation kit by CRISPRa
GA200788 1 Kit

Mouse Plk3 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse 1700017L05Rik activation kit by CRISPRa
GA208157 1 Kit

Mouse 1700017L05Rik activation kit by CRISPRa

Sign In for Pricing
View Details
Sf3b4 Mouse Gene Knockout Kit (CRISPR)
KN315645RB 1 Kit

Sf3b4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ERP29 Human Gene Knockout Kit (CRISPR)
KN210918 1 Kit

ERP29 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human OOEP activation kit by CRISPRa
GA118493 1 Kit

Human OOEP activation kit by CRISPRa

Sign In for Pricing
View Details