Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR10P1 Rabbit Polyclonal Antibody (HRP)

OR10P1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OR12-7, OST701, OR10P1P, OR10P2P, OR10P3P

UniProt

Q8NGE3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR10P1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PFSLIVTSYIRILGAILAMASTQSRRKVFSTCSSHLLVVSLFFGTASITY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_996782

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTMR14 Mouse Monoclonal Antibody [Clone 6F8]
E45M10179V-2 50 µL

MTMR14 Mouse Monoclonal Antibody [Clone 6F8]

Sign In for Pricing
View Details
Avian orthoreovirus One-Step PCR kit
Oneq-V059-150R 150 Reactions

Avian orthoreovirus One-Step PCR kit

Sign In for Pricing
View Details
Influenza A ID-4 Genotyping qPCR Kit
CFP65 100 Tests

Influenza A ID-4 Genotyping qPCR Kit

Sign In for Pricing
View Details
EMX2 (Empty Spiracles Homeobox 2) (HRP)
MBS6179213-01 0.1 mL

EMX2 (Empty Spiracles Homeobox 2) (HRP)

Sign In for Pricing
View Details
EMX2 (Empty Spiracles Homeobox 2) (HRP)
MBS6179213-02 5x 0.1 mL

EMX2 (Empty Spiracles Homeobox 2) (HRP)

Sign In for Pricing
View Details
GENLISA™ Human Synaptotagmin-Like Protein 4 (SYTL4) ELISA
KBH6240 1x 96 Well

GENLISA™ Human Synaptotagmin-Like Protein 4 (SYTL4) ELISA

Sign In for Pricing
View Details