Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR10P1 Rabbit Polyclonal Antibody (Biotin)

OR10P1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

OR12-7, OST701, OR10P1P, OR10P2P, OR10P3P

UniProt

Q8NGE3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR10P1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LFFGTASITYIRPQAGSSVTTDRVLSLFYTVITPMLNPIIYTLRNKDVRR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_996782

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human OBFC1/STN1 Protein (His Tag)
PKSH032832-01 10 µg

Recombinant Human OBFC1/STN1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human OBFC1/STN1 Protein (His Tag)
PKSH032832-02 50 µg

Recombinant Human OBFC1/STN1 Protein (His Tag)

Sign In for Pricing
View Details
Mouse ADP/Acrp30 Antibody Pair Set
E-KAB-0071 50 µL & 100 µg

Mouse ADP/Acrp30 Antibody Pair Set

Sign In for Pricing
View Details
CD29 (Stem Cell Marker) (12G10), CF740 conjugate, 0.1mg/mL
BNC742905-100 1x 100 µL

CD29 (Stem Cell Marker) (12G10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
High Binding 96 well plates - 8 Well Strips on 12 x 8 frame - White PS
MTW01F4-HB8 50x 96 Well Plates

High Binding 96 well plates - 8 Well Strips on 12 x 8 frame - White PS

Sign In for Pricing
View Details
Calcineurin B homologous protein 2 / HCC Antigen 520 (CPTC-CHP2-1), Biotin conjugate, 0.1mg/mL
BNCB2266-500 1x 500 µL

Calcineurin B homologous protein 2 / HCC Antigen 520 (CPTC-CHP2-1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details